PDB entry 1a88

View 1a88 on RCSB PDB site
Description: chloroperoxidase l
Class: haloperoxidase
Keywords: haloperoxidase, oxidoreductase
Deposited on 1998-04-03, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase l
    Species: Streptomyces lividans [TaxId:1916]
    Gene: CPO-L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a88a_
  • Chain 'B':
    Compound: chloroperoxidase l
    Species: Streptomyces lividans [TaxId:1916]
    Gene: CPO-L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a88b_
  • Chain 'C':
    Compound: chloroperoxidase l
    Species: Streptomyces lividans [TaxId:1916]
    Gene: CPO-L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a88c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a88A (A:)
    gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
    rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
    savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
    dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
    llanatlksyeglphgmlsthpevlnpdllafvks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a88B (B:)
    gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
    rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
    savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
    dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
    llanatlksyeglphgmlsthpevlnpdllafvks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a88C (C:)
    gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
    rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
    savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
    dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
    llanatlksyeglphgmlsthpevlnpdllafvks