PDB entry 1a87

View 1a87 on RCSB PDB site
Description: colicin n
Class: bacteriocin
Keywords: bacteriocin, toxin, pore-forming activity
Deposited on 1998-04-03, released 1999-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.173
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin n
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a87a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a87A (A:)
    hgdnnskpkpggnsgnrgnngdgasakvgeititpdnskpgryissnpeysllaklidae
    sikgtevytfhtrkgqyvkvtvpdsnidkmrvdyvnwkgpkynnklvkrfvsqfllfrke
    ekeknekeallkaselvsgmgdklgeylgvkyknvakevandiknfhgrnirsyneamas
    lnkvlanpkmkvnksdkdaivnawkqvnakdmankignlgkafkvadlaikvekireksi
    egyntgnwgpllleveswiiggvvagvaislfgavlsflpisglavtalgvigimtisyl
    ssfidanrvsninniissvir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a87A (A:)
    sakvgeititpdnskpgryissnpeysllaklidaesikgtevytfhtrkgqyvkvtvpd
    snidkmrvdyvnwkgpkynnklvkrfvsqfllfrkeekeknekeallkaselvsgmgdkl
    geylgvkyknvakevandiknfhgrnirsyneamaslnkvlanpkmkvnksdkdaivnaw
    kqvnakdmankignlgkafkvadlaikvekireksiegyntgnwgpllleveswiiggvv
    agvaislfgavlsflpisglavtalgvigimtisylssfidanrvsninniissvir