PDB entry 1a86

View 1a86 on RCSB PDB site
Description: mmp8 with malonic and aspartic acid based inhibitor
Deposited on 1998-04-03, released 1999-05-04
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-04, with a file datestamp of 1999-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a86a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a86A (A:)
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg