PDB entry 1a85

View 1a85 on RCSB PDB site
Description: mmp8 with malonic and asparagine based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: collagenase, matrix metalloproteinase, malonic acid, mmp8, hydrolase-hydrolase inhibitor complex
Deposited on 1998-04-03, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mmp-8
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22894 (0-157)
  Domains in SCOPe 2.08: d1a85a_
• Heterogens: CA, ZN, 0DY

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a85A (A:)
  npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
  rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
  lahssdpgalmypnyafretsnyslpqddidgiqaiyg