PDB entry 1a80

View 1a80 on RCSB PDB site
Description: Native 2,5-DIKETO-D-GLUCONIC acid reductase a from CORYNBACTERIUM SP. complexed with nadph
Class: oxidoreductase
Keywords: oxidoreductase, alpha8/beta8 barrel, 2, 5-diketo-d-gluconic acid, commercial vitamin c synthesis
Deposited on 1998-03-31, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,5-diketo-d-gluconic acid reductase a
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: 2 5-DIKETO-D-GLUCONIC ACID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a80a_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a80A (A:)
    tvpsivlndgnsipqlgygvfkvppadtqraveealevgyrhidtaaiygneegvgaaia
    asgiarddlfittklwndrhdgdepaaaiaeslaklaldqvdlylvhwptpaadnyvhaw
    ekmielraagltrsigvsnhlvphlerivaatgvvpavnqielhpayqqreitdwaaahd
    vkieswgplgqgkydlfgaepvtaaaaahgktpaqavlrwhlqkgfvvfpksvrrerlee
    nldvfdfdltdteiaaidamdpgdgsgrvsahpdevd