PDB entry 1a7v

View 1a7v on RCSB PDB site
Description: cytochrome c' from rhodopseudomonas palustris
Class: electron transport
Keywords: electron transport
Deposited on 1998-03-18, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a7va_
  • Chain 'B':
    Compound: cytochrome c'
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a7vb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a7vA (A:)
qtdviaqrkailkqmgeatkpiaamlkgeakfdqavvqkslaaiaddskklpalfpadsk
tggdtaalpkiwedkakfddlfaklaaaataaqgtikdeaslkaniggvlgnckschddf
rakks

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a7vB (B:)
qtdviaqrkailkqmgeatkpiaamlkgeakfdqavvqkslaaiaddskklpalfpadsk
tggdtaalpkiwedkakfddlfaklaaaataaqgtikdeaslkaniggvlgnckschddf
rakks