PDB entry 1a7t

View 1a7t on RCSB PDB site
Description: metallo-beta-lactamase with mes
Class: hydrolase
Keywords: hydrolase (beta-lactamase), metallo beta-lactamase, zinc
Deposited on 1998-03-17, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.151
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Bacteroides fragilis [TaxId:817]
    Gene: CCRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25910
      • engineered (170)
      • engineered (207)
    Domains in SCOPe 2.07: d1a7ta_
  • Chain 'B':
    Compound: metallo-beta-lactamase
    Species: Bacteroides fragilis [TaxId:817]
    Gene: CCRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25910
      • engineered (170)
      • engineered (207)
    Domains in SCOPe 2.07: d1a7tb_
  • Heterogens: ZN, NA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7tA (A:)
    aqksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqt
    emlvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpe
    hgftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisda
    dvtawpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiestskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7tA (A:)
    svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
    vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
    tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisdadvt
    awpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiests
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a7tB (B:)
    aqksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqt
    emlvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpe
    hgftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisda
    dvtawpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiestskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7tB (B:)
    svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
    vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
    tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisdadvt
    awpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiests