PDB entry 1a7m

View 1a7m on RCSB PDB site
Description: leukaemia inhibitory factor chimera (mh35-lif), nmr, 20 structures
Deposited on 1998-03-16, released 1999-04-20
The last revision prior to the SCOP 1.59 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1a7m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a7m_ (-)
splpitpvnatcairhpchgnlmnqiknqlaqlngsanalfisyytaqgepfpnnldklc
gpnvtdfppfhangtekaklvelyrmvaylsasltnitrdqkvlnpsavslhsklnatid
vmrgllsnvlcrlcnkyrvghvdvppvpdhsdkevfqkkklgcqllgtykqvisvvvqaf