PDB entry 1a7m

View 1a7m on RCSB PDB site
Description: leukaemia inhibitory factor chimera (mh35-lif), nmr, 20 structures
Class: cytokine
Keywords: cytokine, four helical bundle
Deposited on 1998-03-16, released 1999-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukemia inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09056 (0-179)
      • conflict (55-56)
      • conflict (60)
      • conflict (63)
      • conflict (68)
      • conflict (71)
      • conflict (77)
      • conflict (106)
      • conflict (111-112)
      • conflict (154)
      • conflict (157)
    Domains in SCOPe 2.07: d1a7ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7mA (A:)
    splpitpvnatcairhpchgnlmnqiknqlaqlngsanalfisyytaqgepfpnnldklc
    gpnvtdfppfhangtekaklvelyrmvaylsasltnitrdqkvlnpsavslhsklnatid
    vmrgllsnvlcrlcnkyrvghvdvppvpdhsdkevfqkkklgcqllgtykqvisvvvqaf