PDB entry 1a7k

View 1a7k on RCSB PDB site
Description: glycosomal glyceraldehyde-3-phosphate dehydrogenase in a monoclinic crystal form
Deposited on 1998-03-16, released 1998-06-17
The last revision prior to the SCOP 1.65 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7kA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a7kB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a7kC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a7kD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass