PDB entry 1a7k

View 1a7k on RCSB PDB site
Description: glycosomal glyceraldehyde-3-phosphate dehydrogenase in a monoclinic crystal form
Class: oxidoreductase
Keywords: glyceraldehyde-3-phosphate dehydrogenase, glycosome, trypanosome, oxidoreductase
Deposited on 1998-03-16, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7ka1, d1a7ka2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7kb1, d1a7kb2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7kc1, d1a7kc2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7kd1, d1a7kd2
  • Heterogens: PO4, NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7kA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a7kB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a7kC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a7kD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaasskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7kD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass