PDB entry 1a7j

View 1a7j on RCSB PDB site
Description: phosphoribulokinase from rhodobacter spheroides
Class: transferase
Keywords: transferase, kinase, calvin cycle
Deposited on 1998-03-16, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribulokinase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: PRKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7ja_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7jA (A:)
    mskkhpiisvtgssgagtstvkhtfdqifrregvkavsiegdafhrfnradmkaeldrry
    aagdatfshfsyeanelkelervfreygetgqgrtrtyvhddaeaartgvapgnftdwrd
    fdsdshllfyeglhgavvnsevniagladlkigvvpvinlewiqkihrdratrgytteav
    tdvilrrmhayvhcivpqfsqtdinfqrvpvvdtsnpfiarwiptadesvvvirfrnprg
    idfpyltsmihgswmsransivvpgnkldlamqliltplidrvvreskva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7jA (A:)
    skkhpiisvtgsststvkhtfdqifrregvkavsiegdafhrfnradmkaeldrryaagd
    atfshfsyeanelkelervfreygetgqgrtrtyvartgvapgnftdwrdfdsdshllfy
    eglhgavvnsevniagladlkigvvpvinlewiqkihrdratrgytteavtdvilrrmha
    yvhcivpqfsqtdinfqrvpvvdtsnpfiarwiptadesvvvirfrnprgidfpyltsmi
    hgswmsransivvpgnkldlamqliltplidrvvreskv