PDB entry 1a7i

View 1a7i on RCSB PDB site
Description: amino-terminal lim domain from quail cysteine and glycine-rich protein, nmr, minimized average structure
Class: lim domain containing proteins
Keywords: lim domain containing proteins, metal-binding protein, zinc finger
Deposited on 1998-03-15, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: qcrp2 (lim1)
    Species: Coturnix japonica [TaxId:93934]
    Gene: CSRP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7ia1, d1a7ia2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7iA (A:)
    mpnwgggnkcgacgrtvyhaeevqcdgrsfhrccflcmvcrknldsttvaihdaevycks
    cygkkygpkgygygqgagtln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7iA (A:)
    nkcgacgrtvyhaeevqcdgrsfhrccflcmvcrknldsttvaihdaevyckscygkkyg