PDB entry 1a7i

View 1a7i on RCSB PDB site
Description: amino-terminal lim domain from quail cysteine and glycine-rich protein, nmr, minimized average structure
Class: lim domain containing proteins
Keywords: lim domain containing proteins, metal-binding protein, zinc finger
Deposited on 1998-03-15, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: qcrp2 (lim1)
  Species: Coturnix japonica [TaxId:93934]
  Gene: CSRP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05158
  Domains in SCOPe 2.08: d1a7ia1, d1a7ia2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1a7iA (A:)
  mpnwgggnkcgacgrtvyhaeevqcdgrsfhrccflcmvcrknldsttvaihdaevycks
  cygkkygpkgygygqgagtln
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1a7iA (A:)
  nkcgacgrtvyhaeevqcdgrsfhrccflcmvcrknldsttvaihdaevyckscygkkyg