PDB entry 1a7h

View 1a7h on RCSB PDB site
Description: gamma s crystallin c-terminal domain
Class: eye-lens protein
Keywords: eye-lens protein, gamma crystallin s, eye lens protein, multigene family
Deposited on 1998-03-13, released 1998-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gammas crystallin
    Species: Bos taurus [TaxId:9913]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06504 (1-85)
      • correction (3)
    Domains in SCOPe 2.06: d1a7ha_
  • Chain 'B':
    Compound: gammas crystallin
    Species: Bos taurus [TaxId:9913]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06504 (1-85)
      • correction (3)
    Domains in SCOPe 2.06: d1a7hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7hA (A:)
    mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
    dkkeyrkpvdwgaaspavqsfrrive
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7hB (B:)
    mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
    dkkeyrkpvdwgaaspavqsfrrive