PDB entry 1a7h

View 1a7h on RCSB PDB site
Description: gamma s crystallin c-terminal domain
Deposited on 1998-03-13, released 1998-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a7ha_
  • Chain 'B':
    Domains in SCOP 1.55: d1a7hb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7hA (A:)
    mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
    dkkeyrkpvdwgaaspavqsfrrive
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7hB (B:)
    mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
    dkkeyrkpvdwgaaspavqsfrrive