PDB entry 1a7g

View 1a7g on RCSB PDB site
Description: the crystal structure of the e2 DNA-binding domain from human papillomavirus at 2.4 angstroms
Class: transcription regulation
Keywords: transcription regulation, e2, papillomavirus, cervical cancer
Deposited on 1998-03-13, released 1999-04-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: Regulatory protein E2
  Species: Human papillomavirus type 31 [TaxId:10585]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17383 (0-81)
    • conflict (67)
  Domains in SCOPe 2.05: d1a7ge_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a7gE (E:)
  attpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsqr
  ddflntvvipntvsvstgymti