PDB entry 1a7g

View 1a7g on RCSB PDB site
Description: the crystal structure of the e2 dna-binding domain from human papillomavirus at 2.4 angstroms
Deposited on 1998-03-13, released 1999-04-27
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Domains in SCOP 1.57: d1a7ge_

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a7gE (E:)
  attpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsqr
  ddflntvvipntvsvstgymti