PDB entry 1a7e

View 1a7e on RCSB PDB site
Description: hydroxomet myohemerythrin from themiste zostericola
Class: oxygen transport
Keywords: nonheme iron oxygen carrier, oxygen transport
Deposited on 1998-03-12, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myohemerythrin
    Species: Themiste zostericola [TaxId:6437]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02247 (0-117)
      • engineered (102)
    Domains in SCOPe 2.07: d1a7ea_
  • Heterogens: CL, OFO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7eA (A:)
    gweipepyvwdesfrvfyeqldeehkkifkgifdcirdnsapnlatlvkvttnhftheea
    mmdaakysevvphkkmhkdflekigglsapvdaknvdyckewnvnhikgtdfkykgkl