PDB entry 1a7d

View 1a7d on RCSB PDB site
Description: chloromet myohemerythrin from themiste zostericola
Class: oxygen transport
Keywords: nonheme iron oxygen carrier, oxygen transport
Deposited on 1998-03-12, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myohemerythrin
    Species: Themiste zostericola [TaxId:6437]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a7da_
  • Heterogens: CL, CFO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7dA (A:)
    gweipepyvwdesfrvfyeqldeehkkifkgifdcirdnsapnlatlvkvttnhftheea
    mmdaakysevvphkkmhkdflekigglsapvdaknvdyckewlvnhikgtdfkykgkl