PDB entry 1a7c

View 1a7c on RCSB PDB site
Description: human plasminogen activator inhibitor type-1 in complex with a pentapeptide
Class: hydrolase inhibitor/peptide
Keywords: SERINE PROTEASE INHIBITOR, PAI-1, CARBOHYDRATE, INHIBITOR COMPLEX, PROTEASE INHIBITOR-PEPTIDE COMPLEX, HYDROLASE INHIBITOR-PEPTIDE complex
Deposited on 1998-03-12, released 1999-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator inhibitor type 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a7ca_
  • Chain 'B':
    Compound: pentapeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1A7C
  • Chain 'C':
    Compound: pentapeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1A7C
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7cA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnesgtvessstavivsarmapeeiimdrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7cA (A:)
    hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
    mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
    kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
    ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
    ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
    fqadftslsdqeplhvaqalqkvkievnesgtapeeiimdrpflfvvrhnptgtvlfmgq
    vmep
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.