PDB entry 1a7c

View 1a7c on RCSB PDB site
Description: human plasminogen activator inhibitor type-1 in complex with a pentapeptide
Deposited on 1998-03-12, released 1999-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a7ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7cA (A:)
    hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
    mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
    kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
    ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
    ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
    fqadftslsdqeplhvaqalqkvkievnesgtvessstavivsarmapeeiimdrpflfv
    vrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7cA (A:)
    hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
    mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
    kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
    ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
    ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
    fqadftslsdqeplhvaqalqkvkievnesgtapeeiimdrpflfvvrhnptgtvlfmgq
    vmep