PDB entry 1a7b

View 1a7b on RCSB PDB site
Description: engineering a misfolded form of cd2
Deposited on 1998-03-10, released 1998-06-17
The last revision prior to the SCOP 1.57 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2389
AEROSPACI score: -1.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a7ba_
  • Chain 'B':
    Domains in SCOP 1.57: d1a7bb_
  • Chain 'C':
    Domains in SCOP 1.57: d1a7bc_
  • Chain 'D':
    Domains in SCOP 1.57: d1a7bd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7bA (A:)
    tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
    nltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7bB (B:)
    tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
    nltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7bC (C:)
    tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
    nltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a7bD (D:)
    tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
    nltrddsgtynvtvystngtrildkaldlrile