PDB entry 1a7a

View 1a7a on RCSB PDB site
Description: structure of human placental s-adenosylhomocysteine hydrolase: determination of a 30 selenium atom substructure from data at a single wavelength
Class: hydrolase
Keywords: hydrolase, nad binding protein
Deposited on 1998-03-10, released 1999-04-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23526 (1-431)
      • engineered (28)
      • engineered (32)
      • engineered (34)
      • engineered (55)
      • engineered (126)
      • engineered (166-167)
      • engineered (209)
      • engineered (253)
      • engineered (261)
      • engineered (289)
      • engineered (350)
      • engineered (357)
      • engineered (366)
      • engineered (418)
    Domains in SCOPe 2.05: d1a7aa1, d1a7aa2
  • Chain 'B':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23526 (Start-431)
      • engineered (28)
      • engineered (32)
      • engineered (34)
      • engineered (55)
      • engineered (126)
      • engineered (166-167)
      • engineered (209)
      • engineered (253)
      • engineered (261)
      • engineered (289)
      • engineered (350)
      • engineered (357)
      • engineered (366)
      • engineered (418)
    Domains in SCOPe 2.05: d1a7ab1, d1a7ab2
  • Heterogens: NAD, ADC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a7aA (A:)
    msdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvet
    avlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyf
    kdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainv
    ndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvi
    iteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnig
    hfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsn
    sftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgms
    cdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7aA (A:)
    sdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtveta
    vlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyfk
    dgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmsc
    dgpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a7aB (B:)
    msdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvet
    avlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyf
    kdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainv
    ndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvi
    iteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnig
    hfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsn
    sftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgms
    cdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a7aB (B:)
    dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
    lietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
    gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmscd
    gpfkpdhyry