PDB entry 1a78

View 1a78 on RCSB PDB site
Description: complex of toad ovary galectin with thio-digalactose
Class: lectin
Keywords: s-lectin, carbohydrate binding, complex (lectin-saccharide), lectin
Deposited on 1998-03-20, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Bufo arenarum [TaxId:38577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a78a_
  • Chain 'B':
    Compound: galectin-1
    Species: Bufo arenarum [TaxId:38577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a78b_
  • Heterogens: DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a78A (A:)
    asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
    cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf
    lsleglafksitte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a78B (B:)
    asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
    cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf
    lsleglafksitte