PDB entry 1a77

View 1a77 on RCSB PDB site
Description: flap endonuclease-1 from methanococcus jannaschii
Deposited on 1998-03-20, released 1999-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 1999-08-03, with a file datestamp of 1999-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a77_ (-)
    mgvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayng
    vfyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaaky
    akrvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyg
    aprvvrnltttkempelielnevledlrislddlidiaifmgtdynpggvkgigfkraye
    lvrsgvakdvlkkeveyydeikrifkepkvtdnyslslklpdkegiikflvdendfnydr
    vkkhvdklynlianktkqktldawfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a77_ (-)
    gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
    fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
    krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
    prvvrnltttkempelielnevledlrislddlidiaifmgtdynpggvkgigfkrayel
    vrsgvakdvlkkeveyydeikrifkepkvtdnyslslklpdkegiikflvdendfnydrv
    kkhvdklynliankt