PDB entry 1a77

View 1a77 on RCSB PDB site
Description: flap endonuclease-1 from methanococcus jannaschii
Class: 5'-3' exo/endo nuclease
Keywords: 5'-3' exo/endo nuclease, DNA replication, rth, rad27, DNA repair
Deposited on 1998-03-20, released 1999-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flap endonuclease-1 protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a77a1, d1a77a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a77A (A:)
    mgvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayng
    vfyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaaky
    akrvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyg
    aprvvrnltttkempelielnevledlrislddlidiaifmgtdynpggvkgigfkraye
    lvrsgvakdvlkkeveyydeikrifkepkvtdnyslslklpdkegiikflvdendfnydr
    vkkhvdklynlianktkqktldawfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a77A (A:)
    gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
    fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
    krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
    prvvrnltttkempelielnevledlrislddlidiaifmgtdynpggvkgigfkrayel
    vrsgvakdvlkkeveyydeikrifkepkvtdnyslslklpdkegiikflvdendfnydrv
    kkhvdklynliankt