PDB entry 1a74

View 1a74 on RCSB PDB site
Description: i-ppol homing endonuclease/dna complex
Deposited on 1998-03-19, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-22, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a74a_
  • Chain 'B':
    Domains in SCOP 1.55: d1a74b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a74A (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a74B (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv