PDB entry 1a72

View 1a72 on RCSB PDB site
Description: an active-site double mutant (phe93->trp, val203->ala) of horse liver alcohol dehydrogenase in complex with the isosteric nad analog cpad
Class: oxidoreductase
Keywords: oxidoreductase (nad(a)-choh(d)), active site mutant, liver alcohol dehydrogenase, isosteric nad inhibitors, oxidoreductase
Deposited on 1998-03-19, released 1998-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.176
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: horse liver alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: F93W V203ALADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (92)
      • engineered (202)
    Domains in SCOPe 2.06: d1a72a1, d1a72a2
  • Heterogens: ZN, PAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a72A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf