PDB entry 1a71

View 1a71 on RCSB PDB site
Description: ternary complex of an active site double mutant of horse liver alcohol dehydrogenase, phe93=>trp, val203=>ala with nad and trifluoroethanol
Class: oxidoreductase
Keywords: oxidoreductase (nad(a)-choh(d)), liver, alcohol, dehydrogenase, ladh, active site mutant
Deposited on 1998-03-19, released 1998-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: liver alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: LADH F93W V203A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (92)
      • engineered (202)
    Domains in SCOPe 2.06: d1a71a1, d1a71a2
  • Chain 'B':
    Compound: liver alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: LADH F93W V203A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (92)
      • engineered (202)
    Domains in SCOPe 2.06: d1a71b1, d1a71b2
  • Heterogens: ZN, NAD, ETF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a71A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a71B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplwtpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf