PDB entry 1a6y

View 1a6y on RCSB PDB site
Description: reverba orphan nuclear receptor/DNA complex
Class: transcription/DNA
Keywords: orphan receptor, nuclear receptor, DNA-binding, reverb, rev-erb, transcription regulation, transcription/DNA complex
Deposited on 1998-03-04, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orphan nuclear receptor nr1d1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20393
      • cloning artifact (24)
    Domains in SCOPe 2.07: d1a6ya_
  • Chain 'B':
    Compound: orphan nuclear receptor nr1d1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20393
      • cloning artifact (24)
    Domains in SCOPe 2.07: d1a6yb_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*ap*cp*tp*ap*gp*gp*tp*cp*ap*cp*(5it)p*ap*gp*gp*tp*cp*ap*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*gp*ap*cp*cp*tp*ap*gp*tp*gp*ap*cp*cp*tp*ap*gp*tp*tp*g)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6yA (A:)
    tklngmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinr
    nrcqqcrfkkclsvgmsrdavrfgripkrekqrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6yA (A:)
    llckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqcr
    fkkclsvgmsrdavrfgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a6yB (B:)
    tklngmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinr
    nrcqqcrfkkclsvgmsrdavrfgripkrekqrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6yB (B:)
    gmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcq
    qcrfkkclsvgmsrdavrfgripk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.