PDB entry 1a6x

View 1a6x on RCSB PDB site
Description: structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Class: carrier protein
Keywords: acetyl-coa carboxylase, biotin carboxyl carrier protein, nuclear magnetic resonance, backbone dynamics
Deposited on 1998-03-04, released 1998-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apo-biotin carboxyl carrier protein of acetyl-coa carboxylase
  Species: Escherichia coli BL21(DE3) [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABD8 (0-86)
  Domains in SCOPe 2.05: d1a6xa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a6xA (A:)
  meapaaaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqiea
  dksgtvkailvesgqpvefdeplvvie