PDB entry 1a6w

View 1a6w on RCSB PDB site
Description: b1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound
Class: immunoglobulin
Keywords: immunoglobulin, hapten
Deposited on 1998-03-03, released 1998-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: b1-8 fv (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01751 (0-119)
      • variant (115)
    Domains in SCOPe 2.08: d1a6wh_
  • Chain 'L':
    Compound: b1-8 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01724 (0-107)
      • variant (38)
    Domains in SCOPe 2.08: d1a6wl_
  • Heterogens: NIP, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6wH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6wL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle