PDB entry 1a6w
View 1a6w on RCSB PDB site
Description: b1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound
Class: immunoglobulin
Keywords: immunoglobulin, hapten
Deposited on
1998-03-03, released
1998-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: b1-8 fv (heavy chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1a6wh_ - Chain 'L':
Compound: b1-8 fv (light chain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1a6wl_ - Heterogens: NIP, HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1a6wH (H:)
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1a6wL (L:)
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle