PDB entry 1a6v

View 1a6v on RCSB PDB site
Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
Class: immune system
Keywords: immunoglobulin, hapten, immune system
Deposited on 1998-03-03, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.296
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: b1-8 fv (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01751 (0-End)
      • variant (115)
    Domains in SCOPe 2.07: d1a6vh_
  • Chain 'I':
    Compound: b1-8 fv (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01751 (0-End)
      • variant (115)
    Domains in SCOPe 2.07: d1a6vi_
  • Chain 'J':
    Compound: b1-8 fv (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01751 (0-119)
      • variant (115)
    Domains in SCOPe 2.07: d1a6vj_
  • Chain 'L':
    Compound: b1-8 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01724 (0-108)
      • variant (39)
    Domains in SCOPe 2.07: d1a6vl_
  • Chain 'M':
    Compound: b1-8 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01724 (0-108)
      • variant (39)
    Domains in SCOPe 2.07: d1a6vm_
  • Chain 'N':
    Compound: b1-8 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01724 (0-108)
      • variant (39)
    Domains in SCOPe 2.07: d1a6vn_
  • Heterogens: NPC, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a6vH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6vH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1a6vI (I:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6vI (I:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvs
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6vJ (J:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6vL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1a6vM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6vM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1a6vN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6vN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl