PDB entry 1a6t

View 1a6t on RCSB PDB site
Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site
Deposited on 1998-03-03, released 1998-05-27
The last revision prior to the SCOP 1.69 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.169
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tA (A:)
    qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
    fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tB (B:)
    evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
    nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvssakt
    tppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsglyt
    lsssvtvtsstwpsqtitcnvahpasstkvdkkiepr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tC (C:)
    qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
    fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tD (D:)
    evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
    nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvssakt
    tppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsglyt
    lsssvtvtsstwpsqtitcnvahpasstkvdkkiepr