PDB entry 1a6t

View 1a6t on RCSB PDB site
Description:
Deposited on 1998-03-03, released 1998-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.169
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a6ta1, d1a6ta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a6tb1, d1a6tb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a6tc1, d1a6tc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1a6td1, d1a6td2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tA (A:)
    qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
    fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tB (B:)
    evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
    nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvssakt
    tppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsglyt
    lsssvtvtsstwpsqtitcnvahpasstkvdkkiepr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tC (C:)
    qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
    fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6tD (D:)
    evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf
    nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvssakt
    tppsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsglyt
    lsssvtvtsstwpsqtitcnvahpasstkvdkkiepr