PDB entry 1a6s

View 1a6s on RCSB PDB site
Description: m-domain from gag polyprotein of rous sarcoma virus, nmr, 20 structures
Class: Viral protein
Keywords: CORE PROTEIN, VIRUS STRUCTURE, MEMBRANE BINDING, Viral protein
Deposited on 1998-03-02, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Rous sarcoma virus - Prague C [TaxId:11888]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a6sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6sA (A:)
    geavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
    ramilgksgelktwglvlgalkaaree