PDB entry 1a6r

View 1a6r on RCSB PDB site
Description: gal6 (yeast bleomycin hydrolase) mutant c73a
Class: hydrolase
Keywords: bleomycin hydrolase, peptidase, protease, DNA-binding protein, self-compartmentalizing protease, hydrolase
Deposited on 1998-02-27, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gal6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GAL6C73A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01532 (17-470)
      • cloning artifact (18)
      • engineered (89)
    Domains in SCOPe 2.07: d1a6ra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6rA (A:)
    mhhhhhhasenlafqgamassidiskinswnkefqsdlthqlattvlknynaddallnkt
    rlqkqdnrvfntvvstdstpvtnqkssgrawlfaatnqlrlnvlselnlkefelsqaylf
    fydklekanyfldqivssadqdidsrlvqyllaaptedggqysmflnlvkkyglipkdly
    gdlpysttasrkwnsllttklrefaetlrtalkersaddsiivtlreqmqreifrlmslf
    mdippvqpneqftweyvdkdkkihtikstplefaskyakldpstpvslindprhpygkli
    kidrlgnvlggdaviylnvdnetlsklvvkrlqnnkavffgshtpkfmdkktgvmdielw
    nypaigynlpqqkasriryheslmthamlitgchvdetsklplryrvenswgkdsgkdgl
    yvmtqkyfeeycfqivvdinelpkelaskftsgkeepivlpiwdpmgalak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6rA (A:)
    afqgamassidiskinswnkefqsdlthqlattvlknynaddallnktrlqkqdnrvfnt
    vvstdstpvtnqkssgrawlfaatnqlrlnvlselnlkefelsqaylffydklekanyfl
    dqivssadqdidsrlvqyllaaptedggqysmflnlvkkyglipkdlygdlpysttasrk
    wnsllttklrefaetlrtalkersaddsiivtlreqmqreifrlmslfmdippvqpneqf
    tweyvdkdkkihtikstplefaskyakldpstpvslindprhpygklikidrlgnvlggd
    aviylnvdnetlsklvvkrlqnnkavffgshtpkfmdkktgvmdielwnypaigynlpqq
    kasriryheslmthamlitgchvdetsklplryrvenswgkdsgkdglyvmtqkyfeeyc
    fqivvdinelpkelaskftsgkeepivlpiwdpmgalak