PDB entry 1a6p

View 1a6p on RCSB PDB site
Description: engineering of a misfolded form of cd2
Deposited on 1998-02-26, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.2186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a6pa_
  • Chain 'B':
    Domains in SCOP 1.55: d1a6pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6pA (A:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6pB (B:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile