PDB entry 1a6n

View 1a6n on RCSB PDB site
Description: deoxy-myoglobin, atomic resolution
Class: oxygen transport
Keywords: heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transport
Deposited on 1998-02-26, released 1999-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.122
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a6na_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6nA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgy