PDB entry 1a6m

View 1a6m on RCSB PDB site
Description: oxy-myoglobin, atomic resolution
Deposited on 1998-02-26, released 1999-04-06
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-06, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.1269
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1a6m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6m_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgy