PDB entry 1a6m

View 1a6m on RCSB PDB site
Description: oxy-myoglobin, atomic resolution
Class: oxygen transport
Keywords: heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transport
Deposited on 1998-02-26, released 1999-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.127
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-150)
  Domains in SCOPe 2.08: d1a6ma_
• Heterogens: SO4, HEM, OXY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a6mA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgy