PDB entry 1a6l

View 1a6l on RCSB PDB site
Description: t14c mutant of azotobacter vinelandii fdi
Class: electron transport
Keywords: electron transport, iron-sulfur
Deposited on 1998-02-26, released 1998-05-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Azotobacter vinelandii [TaxId:354]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00214 (0-105)
    • engineered (13)
  Domains in SCOPe 2.01: d1a6la_
• Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a6lA (A:)
  afvvtdncikckycdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler