PDB entry 1a6k

View 1a6k on RCSB PDB site
Description: aquomet-myoglobin, atomic resolution
Deposited on 1998-02-26, released 1999-04-06
The last revision prior to the SCOP 1.65 freeze date was dated 1999-04-06, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1323
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1a6k__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a6k_ (-)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy