PDB entry 1a6i

View 1a6i on RCSB PDB site
Description: tet repressor, class d variant
Class: transcription regulation
Keywords: transcription regulation, repressor, DNA-binding
Deposited on 1998-02-25, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-End)
      • engineered (3-6)
      • engineered (9-10)
      • engineered (18)
      • engineered (21)
      • engineered (34)
    Domains in SCOPe 2.07: d1a6ia1, d1a6ia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6iA (A:)
    srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqivggdkliipfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6iA (A:)
    srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehlppllrealqimdsddgeqaflhgleslir
    gfevqltallqiv