PDB entry 1a6g

View 1a6g on RCSB PDB site
Description: carbonmonoxy-myoglobin, atomic resolution
Deposited on 1998-02-25, released 1998-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 1998-10-21, with a file datestamp of 1998-10-21.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.1284
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1a6g__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a6g_ (-)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgy