PDB entry 1a6g

View 1a6g on RCSB PDB site
Description: carbonmonoxy-myoglobin, atomic resolution
Class: heme protein
Keywords: heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates
Deposited on 1998-02-25, released 1998-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.128
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-150)
  Domains in SCOPe 2.08: d1a6ga_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a6gA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gnfgadaqgamnkalelfrkdiaakykelgy