PDB entry 1a6f

View 1a6f on RCSB PDB site
Description: RNAse p protein from bacillus subtilis
Class: endonuclease
Keywords: endonuclease, RNAse, subunit
Deposited on 1998-02-24, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease p protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a6fa_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6fA (A:)
    mahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmr
    nrikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslykksssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6fA (A:)
    ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn
    rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk