PDB entry 1a6d

View 1a6d on RCSB PDB site
Description: thermosome from t. acidophilum
Deposited on 1998-02-24, released 1999-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6dA (A:)
    reqgknaqrnnieaakaiadavrttlgpkgmdkmlvdsigdiiisndgatilkemdvehp
    takmivevskaqdtavgdgtttavvlsgellkqaetlldqgvhptvisngyrlavneark
    iideiaekstddatlrkialtalsgkntglsndfladlvvkavnavaevrdgktivdtan
    ikvdkknggsvndtqfisgividkekvhskmpdvvknakialidsaleikkteieakvqi
    sdpskiqdflnqetntfkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkks
    dmeklakatgakivtdlddltpsvlgeaetveerkigddrmtfvmgcknpkavsilirgg
    tdhvvseveralndairvvaitkedgkflwgggaveaelamrlakyansvggreqlaiea
    fakaleiiprtlaenagidpintliklkaddekgrisvgvdldnngvgdmkakgvvdplr
    vkthalesavevatmilriddvi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6dB (B:)
    kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
    mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
    istkigadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniq
    vvkkqggaiddtqlingiivdkekvhpgmpdvvkdakialldapleikkpefdtnlried
    psmiqkflaqeenmlremvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdm
    dklakatgasivstideisssdlgtaerveqvkvgedymtfvtgcknpkavsilvrgete
    hvvdemersitdslhvvasaledgayaagggataaeiafrlrsyaqkiggrqqlaiekfa
    daieeipralaenagldpidillklraehakgnktyginvftgeiedmvkngviepirvg
    kqaiesateaaimilriddvia