PDB entry 1a6d

View 1a6d on RCSB PDB site
Description: thermosome from t. acidophilum
Class: chaperonin
Keywords: thermoplasma acidophilum, group II chaperonin, cct, tric, protein folding, ATPase, chaperonin
Deposited on 1998-02-24, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermosome (alpha subunit)
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6da1, d1a6da2, d1a6da3
  • Chain 'B':
    Compound: thermosome (beta subunit)
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6db1, d1a6db2, d1a6db3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a6dA (A:)
    mmtgqvpilvlkegtqreqgknaqrnnieaakaiadavrttlgpkgmdkmlvdsigdiii
    sndgatilkemdvehptakmivevskaqdtavgdgtttavvlsgellkqaetlldqgvhp
    tvisngyrlavnearkiideiaekstddatlrkialtalsgkntglsndfladlvvkavn
    avaevrdgktivdtanikvdkknggsvndtqfisgividkekvhskmpdvvknakialid
    saleikkteieakvqisdpskiqdflnqetntfkqmvekikksganvvlcqkgiddvaqh
    ylakegiyavrrvkksdmeklakatgakivtdlddltpsvlgeaetveerkigddrmtfv
    mgcknpkavsilirggtdhvvseveralndairvvaitkedgkflwgggaveaelamrla
    kyansvggreqlaieafakaleiiprtlaenagidpintliklkaddekgrisvgvdldn
    ngvgdmkakgvvdplrvkthalesavevatmilriddviaskkstppsgqggqgqgmpgg
    gmpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6dA (A:)
    reqgknaqrnnieaakaiadavrttlgpkgmdkmlvdsigdiiisndgatilkemdvehp
    takmivevskaqdtavgdgtttavvlsgellkqaetlldqgvhptvisngyrlavneark
    iideiaekstddatlrkialtalsgkntglsndfladlvvkavnavaevrdgktivdtan
    ikvdkknggsvndtqfisgividkekvhskmpdvvknakialidsaleikkteieakvqi
    sdpskiqdflnqetntfkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkks
    dmeklakatgakivtdlddltpsvlgeaetveerkigddrmtfvmgcknpkavsilirgg
    tdhvvseveralndairvvaitkedgkflwgggaveaelamrlakyansvggreqlaiea
    fakaleiiprtlaenagidpintliklkaddekgrisvgvdldnngvgdmkakgvvdplr
    vkthalesavevatmilriddvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a6dB (B:)
    miagqpifilkegtkresgkdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivit
    ndgvtilkemdvehpaakmmvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhpt
    visegyrmaseeakrvideistkigadekalllkmaqtslnsksasvakdklaeisyeav
    ksvaelrdgkyyvdfdniqvvkkqggaiddtqlingiivdkekvhpgmpdvvkdakiall
    dapleikkpefdtnlriedpsmiqkflaqeenmlremvdkiksvganvvitqkgiddmaq
    hylsragiyavrrvkksdmdklakatgasivstideisssdlgtaerveqvkvgedymtf
    vtgcknpkavsilvrgetehvvdemersitdslhvvasaledgayaagggataaeiafrl
    rsyaqkiggrqqlaiekfadaieeipralaenagldpidillklraehakgnktyginvf
    tgeiedmvkngviepirvgkqaiesateaaimilriddviatkssssssnppksgssses
    sed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a6dB (B:)
    kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
    mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
    istkigadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniq
    vvkkqggaiddtqlingiivdkekvhpgmpdvvkdakialldapleikkpefdtnlried
    psmiqkflaqeenmlremvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdm
    dklakatgasivstideisssdlgtaerveqvkvgedymtfvtgcknpkavsilvrgete
    hvvdemersitdslhvvasaledgayaagggataaeiafrlrsyaqkiggrqqlaiekfa
    daieeipralaenagldpidillklraehakgnktyginvftgeiedmvkngviepirvg
    kqaiesateaaimilriddvia