PDB entry 1a6b

View 1a6b on RCSB PDB site
Description: nmr structure of the complex between the zinc finger protein ncp10 of moloney murine leukemia virus and a sequence of the psi-packaging domain of hiv-1, 20 structures
Deposited on 1998-02-23, released 1999-08-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-02, with a file datestamp of 1999-11-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.55: d1a6bb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6bB (B:)
    gerrrsqldrdqcayckekghwakdcpkkprgprgprpqt